SAB5702129

Anti-LGI1 Antibody, clone 2P8Z9, Rabbit Monoclonal

• Synonyme(s) : LGI1, ADLTE, ADPAEF, ADPEAF, EPITEMPIN, EPT, ETL1, IB1099, leucine rich glioma inactivated 1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 2P8Z9, monoclonal
• Forme: liquid
• Poids mol.: 64 kDa
• Espèces réactives: rat, human, rat
• Concentration: 0.67 mg/mL
• Technique(s): western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: NLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYV
• Numéro d'accès UniProt: O95970
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... Lgi1(9211)

Description

Description générale

This gene encodes a member of the secreted leucine-rich repeat (LRR) superfamily and shares homology with members of the SLIT protein family. The encoded protein may regulate the activity of voltage-gated potassium channels and may be involved in neuronal growth regulation and cell survival. This gene is rearranged as a result of translocations in glioblastoma cell lines, and it is frequently down-regulated or rearranged in malignant gliomas. Mutations in this gene result in autosomal dominant lateral temporal epilepsy. Alternative splicing results in multiple transcript variants.

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 150-250 of human LGI1 (O95970).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1