SAB5201362

Monoclonal Anti-Ataxin - Atto 655 antibody produced in mouse

clone S76-8, purified immunoglobulin

• Synonyme(s) : Anti-ATX1, Anti-D6S504E, Anti-Spinocerebellar ataxia type 1 protein
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: Atto 655 conjugate
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: S76-8, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen predicted mol wt 85 kDa
• Espèces réactives: human, mouse, rat
• Concentration: 1 mg/mL
• Technique(s): immunohistochemistry: suitable; immunoprecipitation (IP): suitable; western blot: suitable
• Isotype: IgG2b
• Numéro d'accès NCBI: NP_001186233.1
• Numéro d'accès UniProt: P54253
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: mouse ... Atxn1(20238)

Description

Immunogène

Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).

Caractéristiques et avantages

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Forme physique

PBS pH 7.4, 50% glycerol, 0.1% sodium azide

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable