Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

SAB2108408

Sigma-Aldrich

Anti-SLC16A3 antibody produced in rabbit

affinity isolated antibody

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

50kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunoblotting: suitable

Numéro d'accès NCBI

NM_030696

Numéro d'accès UniProt

P57787

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SLC16A3(9123)

Description générale

Solute carrier family 16 member 3 (SLC16A3) encodes monocarboxylate transporter 4 (MCT4). MCT4 is targeted by the chaperone CD147 to the basolateral plasma membrane. MCT4 is highly expressed in astrocytes, skeletal muscle fibres, chondrocytes, placenta. In human chromosome, the gene SLC16A3 is located on 17q25.3.

Immunogène

Synthetic peptide directed towards the N terminal of human SLC16A3

Actions biochimiques/physiologiques

Slc16a3 is a proton-linked monocarboxylate transporter. It catalyses the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. MCT4 is upregulated in the hypoxic environment in glioblastoma, and is implicated in solid tumours like breast cancer and bladder cancer and leads to metastasis.

Séquence

Synthetic peptide located within the following region: KAVSVFFKELMHEFGIGYSDTAWISSILLAMLYGTGPLCSVCVNRFGCRP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

DNA methylation of the SLC16A3 promoter regulates expression of the human lactate transporter MCT4 in renal cancer with consequences for clinical outcome
Fisel P, et al.
Clinical Cancer Research, 19(18), 5170-5181 (2013)
Identifying differential expression genes and single nucleotide variations using RNA-seq in metastatic melanoma
Liu D, et al.
Genetics and molecular research : GMR, 13, 8153-8162 (2014)
Partial maternal heterodisomy of chromosome 17q25 in a case of severe mental retardation
Rio M, et al.
Human Genetics, 108(6), 511-515 (2001)
Genetic variations of the MCT4 (SLC16A3) gene in the Chinese and Indian populations of Singapore
Lean CB and Lee EJD
Drug Metabolism and Pharmacokinetics, 27(4), 456-464 (2012)
Butyric acid increases trans epithelial transport of ferulic acid through upregulation of the monocarboxylate transporters SLC16A1 (MCT1) and SLC16A3 (MCT4)
Ziegler K, et al.
Archives of Biochemistry and Biophysics, 599, 3-12 (2016)
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique