SAB2103083

Anti-TRIM33 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-FLJ32925, Anti-PTC7, Anti-RFG7, Anti-TF1G, Anti-TIF1G
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 122 kDa
• Espèces réactives: guinea pig, bovine, rat, mouse, human, horse, rabbit, dog
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunofluorescence: suitable; western blot: suitable
• Numéro d'accès NCBI: NM_015906
• Numéro d'accès UniProt: Q9UPN9
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: human ... TRIM33(51592)

Description

Immunogène

Synthetic peptide directed towards the middle region of human TRIM33

Actions biochimiques/physiologiques

TRIM33 is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined.

Séquence

Synthetic peptide located within the following region: EIYSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable