SAB2102632

Anti-UBQLN1 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-DA41, Anti-DSK2, Anti-FLJ90054, Anti-PLIC-1, Anti-Ubiquilin 1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 62 kDa
• Espèces réactives: guinea pig, rat, human, dog, bovine, horse, rabbit, sheep
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès UniProt: Q9UMX0
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... UBQLN1(29979)

Description

Description générale

The previously assigned protein identifier Q5T6J9 has been merged into Q9UMX0. Full details can be found on the UniProt database.

Immunogène

Synthetic peptide directed towards the middle region of human UBQLN1

Actions biochimiques/physiologiques

UBQLN1 is an ubiquitin-like protein (ubiquilin) that shares a high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain an N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to modulate accumulation of presenilin proteins, and it is found in lesions associated with Alzheimer′s and Parkinson′s disease. Two transcript variants encoding different isoforms have been found for this gene.This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to modulate accumulation of presenilin proteins, and is found in lesions associated with Alzheimer′s and Parkinson′s disease. Two transcript variants encoding different isoforms have been found for this gene.

Séquence

Synthetic peptide located within the following region: QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable