Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

SAB2102460

Sigma-Aldrich

Anti-TMEM16A antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-FLJ10261, Anti-ORAOV2, Anti-TAOS2, Anti-Transmembrane protein 16A

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

lyophilized powder

Poids mol.

111 kDa

Espèces réactives

rat, guinea pig, mouse, bovine, human, rabbit, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TMEM16A(55107)

Immunogène

The immunogen for anti-TMEM16A antibody: synthetic peptide derected towards the middle region of human TMEM16A

Séquence

Synthetic peptide located within the following region: HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY

Forme physique

Lyophilized from PBS buffer with 2% sucrose

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

12 - Non Combustible Liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Raphael Courjaret et al.
Journal of cell science, 129(13), 2548-2558 (2016-05-14)
Ca(2+)-activated Cl(-) channels (CaCCs) play important physiological functions in epithelia and other tissues. In frog oocytes the CaCC Ano1 regulates resting membrane potential and the block to polyspermy. Here, we show that Ano1 expression increases the oocyte surface, revealing a

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique