Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

SAB2101578

Sigma-Aldrich

Anti-NFATC3 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-NFAT4, Anti-NFATX, Anti-Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

115 kDa

Espèces réactives

dog, mouse, human, horse, bovine

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... NFATC3(4775)

Description générale

The nuclear factor of activated T cells 3 (NFATc3)/nuclear factor of activated T cells 4 (NFAT4) belongs to the NFAT family. It is expressed at high levels in the thymus. NFATc3 has a rel similarity domain (RSD) and the SP repeat region, characterized by the repeated motif SPxxSPxxSPrxsxx(D/E)(D/E)swl. The NFATc3 gene is located on human chromosome 16.

Immunogène

Synthetic peptide directed towards the N terminal region of human NFATC3

Application

Anti-NFATC3 antibody produced in rabbit has been used in western blot analysis (1:1000).

Actions biochimiques/physiologiques

The nuclear factor of activated T cells 3 (NFATc3)/nuclear factor of activated T cells 4 (NFAT4) exhibits either pro-tumor or anti-tumor effects. It can block the proliferation and migration abilities of hepatoma cells. NFATc3 aids in reducing hepatitis B virus (HBV) replication. It can activate transcription. NFAT4 is necessary to drive the expression of the human polyomavirus JC virus (JCV) gene in glial cells.

Séquence

Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

S N Ho et al.
The Journal of biological chemistry, 270(34), 19898-19907 (1995-08-25)
Signals transduced by the T cell antigen receptor (TCR) regulate developmental transitions in the thymus and also mediate the immunologic activation of mature, peripheral T cells. In both cases TCR stimulation leads to the assembly of the NFAT transcription complex
Kate Manley et al.
Journal of virology, 80(24), 12079-12085 (2006-10-13)
The human polyomavirus JC virus (JCV) infects 70% of the population worldwide. In immunosuppressed patients, JCV infection can lead to progressive multifocal leukoencephalopathy (PML), a fatal demyelinating disease of the central nervous system (CNS). The majority of PML cases occur
Xiaobin Zao et al.
Oncoimmunology, 10(1), 1869388-1869388 (2021-02-02)
Nuclear factor of activated T cells 3 (NFATc3) has been reported to upregulate type I interferons (IFNs) expression, and the abnormal expression and activation of NFATc3 were closely related to tumorigenesis. However, the potential function of NFATc3 in hepatitis B
Patrick Nasarre et al.
Cancers, 13(11) (2021-06-03)
Secreted frizzled-related protein 2 (SFRP2) promotes the migration/invasion of metastatic osteosarcoma (OS) cells and tube formation by endothelial cells. However, its function on T-cells is unknown. We hypothesized that blocking SFRP2 with a humanized monoclonal antibody (hSFRP2 mAb) can restore

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique