Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

SAB2101047

Sigma-Aldrich

Anti-HMG20A antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-FLJ10739, Anti-HMGX1, Anti-High-mobility group 20A

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

40 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... HMG20A(10363)

Description générale

HMG20A (high mobility group 20A) is located on human chromosome 15q24. It is a high mobility group (HMG) domain-containing protein.

Immunogène

Synthetic peptide directed towards the N terminal region of human HMG20A

Actions biochimiques/physiologiques

HMG20A (high mobility group 20A) plays a role in neuronal differentiation as chromatin-associated protein. It overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. The protein also acts as an inhibitor of HMG20B. It involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4.
HMG20A is essential for SNAI1 (snail family transcriptional repressor 1)-mediated epithelial to mesenchymal transition.

Séquence

Synthetic peptide located within the following region: ENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPEF

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

HMG20A and HMG20B map to human chromosomes 15q24 and 19p13. 3 and constitute a distinct class of HMG-box genes with ubiquitous expression
Sumoy L, et al.
Cytogenetic and genome research, 88(1-2), 62-67 (2000)
HMG20A is required for SNAI1-mediated epithelial to mesenchymal transition
Rivero S, et al.
Oncogene, 34(41), 5264-5264 (2015)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique