SAB2100754

Anti-FAM134C antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-FLJ33806, Anti-Family with sequence similarity 134, member C
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 51 kDa
• Espèces réactives: horse, bovine, human, mouse, dog, rat, rabbit
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès UniProt: Q86VR2
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... FAM134C(162427)

Description

Immunogène

Synthetic peptide directed towards the N terminal region of human FAM134C

Actions biochimiques/physiologiques

FAM134C belongs to the FAM134 family

Séquence

Synthetic peptide located within the following region: EAAQRALVEVLGPYEPLLSRVQAALVWERPARSALWCLGLNAAFWFFALT

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable