SAB1413292

Monoclonal Anti-CLDN6 antibody produced in mouse

clone 1P8, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : CLDN6
• Code UNSPSC : 51111800

Propriétés

• Conjugué: unconjugated
• Niveau de qualité: 100
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 1P8, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: 23.3 kDa
• Espèces réactives: human
• Concentration: ~0.3-1 μg/μL (Please refer to lot specific concentration)
• Technique(s): ELISA: suitable
• Isotype: IgG2b, kappa
• Numéro d'accès Protein ID: NM_021195.3
• Conditions d'expédition: dry ice
• Température de stockage: -10 to -25°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CLDN6(9074)

Description

Description générale

Mouse monoclonal antibody raised against a full-length recombinant CLDN6.

Immunogène

CLDN6 (NP_067018.1, 1 a.a. ~ 220 a.a) full-length recombinant protein with GST tag.

Séquence

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAVIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

Forme physique

Solution in phosphate buffered saline, pH 7.4

Notes préparatoires

Purification by Protein A sepharose

Stockage et stabilité

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 2
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable