Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

SAB1412855

Sigma-Aldrich

Monoclonal Anti-LRRC8A antibody produced in mouse

clone 8H9, purified immunoglobulin

Synonyme(s) :

Anti-FLJ10337, Anti-FLJ41617, Anti-KIAA1437, Anti-LRRC8

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
498,00 €

498,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μG
498,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

498,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

8H9, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen 36.74 kDa

Espèces réactives

human

Technique(s)

ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2a

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... LRRC8A(56262)

Description générale

Leucine rich repeat containing eight family member A (LRRC8A) is a 94 kDa LRR-containing protein, encoded by the gene mapped to human chromosome 9q34.11. The encoded protein is ubiquitously expressed, but at higher levels on the surface of thymocytes than on other immune cells.
This gene encodes a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. This family member is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. (provided by RefSeq)

Immunogène

LRRC8A (NP_062540.2, 711 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA

Actions biochimiques/physiologiques

Leucine rich repeat containing eight family member A (LRRC8A) plays an important role in T cell development, survival and function. It also plays an essential role in B-cell development. In mouse, mutation in the gene leads to abnormalities of B cell development. In addition, mutation in the gene is also associated with the development of non-Bruton type agammaglobulinemia in humans.

Caractéristiques et avantages

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Dawid Deneka et al.
Nature communications, 12(1), 5435-5435 (2021-09-16)
Members of the LRRC8 family form heteromeric assemblies, which function as volume-regulated anion channels. These modular proteins consist of a transmembrane pore and cytoplasmic leucine-rich repeat (LRR) domains. Despite their known molecular architecture, the mechanism of activation and the role
Identification of a lung cancer antigen evading CTL attack due to loss of human leukocyte antigen (HLA) class I expression
Baba T,et al.
Cancer Science, 101(10), 2115-2120 (2010)
BTKbase: the mutation database for X?linked agammaglobulinemia.
Valiaho J, et al.
Human Mutation, 27(12), 1209-1217 (2006)
Sonja Rutz et al.
Nature structural & molecular biology, 30(1), 52-61 (2022-12-16)
Volume-regulated anion channels (VRACs) participate in the cellular response to osmotic swelling. These membrane proteins consist of heteromeric assemblies of LRRC8 subunits, whose compositions determine permeation properties. Although structures of the obligatory LRRC8A, also referred to as SWELL1, have previously
Lalit Kumar et al.
The Journal of experimental medicine, 211(5), 929-942 (2014-04-23)
Lrrc8a is a ubiquitously expressed gene that encodes a leucine-rich repeat (LRR)-containing protein detected at higher levels on the surface of thymocytes than on other immune cells. We generated Lrrc8a(-/-) mice to investigate the role of LRRC8A in lymphocyte development

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique