Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

SAB1411910

Sigma-Aldrich

ANTI-PPARGC1A antibody produced in mouse

clone 3B5, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

LEM6, PGC-1(alpha), PGC-1v, PGC1, PPARGC1A

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
417,00 €

417,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μG
417,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

417,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3B5, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen 37.84 kDa

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

Description générale

PPARG (peroxisome proliferator activated receptor gamma) coactivator 1 α (PPARGC1A) is a 91kDa multifunctional regulatory factor, encoded by the gene mapped to human chromosome 4p15.1. The encoded protein is mainly expressed in heart, skeletal muscle and kidney.
The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. (provided by RefSeq)

Immunogène

PPARGC1A (NP_037393, 689 a.a. ~ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR

Actions biochimiques/physiologiques

PPARG coactivator 1 α (PPARGC1A) interacts with a wide range of transcription factors and plays a vital role in cellular energy metabolism. The encoded protein regulates activity of many transcription factors and functions as a molecular switch for various cellular processes, such as mitochondrial biogenesis and respiration, gluconeogenesis and glucose transport, glycogenolysis, fatty acid oxidation, peroxisomal remodeling, muscle fiber-type switching and oxidative phosphorylation. Additionally, it is also acts as a regulator of Type 2 diabetes mellitus (T2DM) and is considered to be a potential target for anti-diabetic therapy. The protein functions as a tumor suppressor in hepatocellular carcinoma and can be used as a promising therapeutic target for the same. It is downregulated in prostate cancer. Presence of PPARGC1A inhibits prostate cancer progression and metastasis. However, presence of this protein gives selective advantages in breast cancer and melanoma cells.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Chi Luo et al.
Nature, 537(7620), 422-426 (2016-09-01)
Melanoma is the deadliest form of commonly encountered skin cancer because of its rapid progression towards metastasis. Although metabolic reprogramming is tightly associated with tumour progression, the effect of metabolic regulatory circuits on metastatic processes is poorly understood. PGC1α is
Haijiang Wu et al.
The Journal of endocrinology, 229(3), R99-R115 (2016-04-21)
Type 2 diabetes mellitus (T2DM) is a chronic disease characterized by glucose metabolic disturbance. A number of transcription factors and coactivators are involved in this process. Peroxisome proliferator-activated receptor gamma coactivator 1 alpha (PGC-1α) is an important transcription coactivator regulating
Rui Liu et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 39(4), 1010428317695031-1010428317695031 (2017-04-07)
Peroxisome proliferator-activated receptor gamma coactivator-1 alpha plays a crucial role in regulating the biosynthesis of mitochondria, which is closely linked to the energy metabolism in various tumors. This study investigated the regulatory role of peroxisome proliferator-activated receptor gamma coactivator-1 alpha
Veronica Torrano et al.
Nature cell biology, 18(6), 645-656 (2016-05-24)
Cellular transformation and cancer progression is accompanied by changes in the metabolic landscape. Master co-regulators of metabolism orchestrate the modulation of multiple metabolic pathways through transcriptional programs, and hence constitute a probabilistically parsimonious mechanism for general metabolic rewiring. Here we

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique