Accéder au contenu
Merck
Toutes les photos(2)

Documents

SAB1410166

Sigma-Aldrich

Anti-NUDT5 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

YSA1, YSA1H, hYSAH1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

antigen 24.3 kDa

Espèces réactives

human

Technique(s)

immunofluorescence: suitable
western blot: 1 μg/mL

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... NUDT5(11164)

Description générale

Nudix hydrolases, such as NUDT5, eliminate toxic nucleotide derivatives from the cell and regulate the levels of important signaling nucleotides and their metabolites (McLennan, 1999 [PubMed 10373642]).[supplied by OMIM

Immunogène

NUDT5 (NP_054861.2, 1 a.a. ~ 219 a.a) full-length human protein.

Sequence
MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF

Actions biochimiques/physiologiques

NUDT5 (Nudix, nucleoside diphosphate linked moiety X-type motif 5) is mainly involved in maintaining the intracellular level of ADP-ribose by hydrolyzing ADP-ribose (ADPR) to AMP and ribose 5′-phosphate. It also restricts non-enzymatic ADP-ribosylation. Its N-terminal antiparallel β-sheet plays an important role in dimerization, which is essential for substrate recognition and enzymatic activity. NUDT5 has also been predicted for altered cell proliferation. It has been suggested that cells with suppressed NUDT5 shows delayed cell cycle G1 phase. Thus, it has been concluded that NUDT5 may involve in cell growth and cell cycle proliferation by regulating G1-S transition in mammalian cells.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Li-Qun Zhang et al.
Molecular and cellular biochemistry, 363(1-2), 377-384 (2011-12-28)
The molecule 8-oxo-7,8-dihydroguanine (8-oxoGua), an oxidized form of guanine, can pair with adenine or cytosine during nucleic acid synthesis. Moreover, RNA containing 8-oxoGua causes translational errors, thus leading to the production of abnormal proteins. Human NUDT5, a MutT-related protein, catalyzes
Manwu Zha et al.
Journal of molecular biology, 364(5), 1021-1033 (2006-10-21)
Human NUDT5 (hNUDT5) is an ADP-ribose pyrophosphatase (ADPRase) belonging to the Nudix hydrolase superfamily. It presumably plays important roles in controlling the intracellular level of ADP-ribose (ADPR) to prevent non-enzymatic ADP-ribosylation by hydrolyzing ADPR to AMP and ribose 5'-phosphate. We
Hong-Nu Yu et al.
Biochemical and biophysical research communications, 354(3), 764-768 (2007-01-31)
The ADP-ribose (ADPR) pyrophosphatase (ADPRase) NUDT5, a member of a superfamily of Nudix hydrolases, hydrolyzes ADP-ribose (ADPR) to AMP and ribose 5'-phosphate. Nitric oxide (NO) enhances nonenzymatic ADP-ribosylation of proteins such as beta-actin and glyceraldehydes 3-phosphate dehydrogenase in the presence

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique