Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

SAB1409677

Sigma-Aldrich

Monoclonal Anti-BMP7 antibody produced in mouse

clone 1E10, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

OP-1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1E10, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen 36.41 kDa

Espèces réactives

human

Technique(s)

indirect ELISA: suitable

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... BMP7(655)

Description générale

The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development and possible bone inductive activity. (provided by RefSeq)

Immunogène

BMP7 (NP_001710, 293 a.a. ~ 390 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPET

Actions biochimiques/physiologiques

As implied by their name, bone morphogenetic proteins (BMPs) promote and regulate bone development and growth. BMP-7 induces apoptosis in B-cells. It has a role in organ development and may have a role in liver regeneration. Mutations in the gene encoding the protein have been shown to affect the development of teeth, palate and other orofacial complexes.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Applications of small molecule BMP inhibitors in physiology and disease.
Hong CC and Yu PB
Cytokine & Growth Factor Reviews, 20(5-6), 409-418 (2009)
Are bone morphogenetic protein-7 (BMP-7) serum levels correlated with development of hepatic fibrosis?
Aktug Demir N
Journal of Infection in Developing Countries, 8(5), 605-610 (2014)
BMP7 expression correlates with secondary drug resistance in mantle cell lymphoma.
Camara-Clayette V
PLoS ONE, 8(9), e73993-e73993 (2013)
BMP7 Gene involved in nonsyndromic orofacial clefts in Western Han Chinese.
Yu Q
Medicina Oral, patologia Oral y cirugia Bucal, 20(3), e298-e304 (2015)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique