SAB1404851

Monoclonal Anti-TRIM16 antibody produced in mouse

clone 5G11, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : EBBP
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 5G11, monoclonal
• Forme: buffered aqueous solution
• Poids mol.: antigen ~38.1 kDa
• Espèces réactives: human
• Technique(s): capture ELISA: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès NCBI: NM_006470
• Numéro d'accès UniProt: O95361
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TRIM16(10626)

Description

Description générale

This gene was identified as an estrogen and anti-estrogen regulated gene in epithelial cells stably expressing estrogen receptor. The protein encoded by this gene contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. The proteins of this family have been reported to be involved in a variety of biological processes including cell growth, differentiation and pathogenesis. Expression of this gene was detected in most tissues. Its function, however, has not yet been determined. (provided by RefSeq)

Immunogène

TRIM16 (NP_006461, 165 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERMA

Actions biochimiques/physiologiques

The gene TRIM16 (tripartite motif containing 16), also referred to as estrogen-responsive B box protein (EBBP), encodes a protein that has the ability to heterodimerize with other TRIM proteins and also has E3 ubiquitin ligase activity. It is found to positively regulate transcriptional regulator of the retinoic acid receptor β2 (RARβ2) gene. Overexpression of trim16 facilitates retinoid-induced differentiation, reduces neuroblastoma cell growth, migration, and considerably decreases tumorigenicity in vivo.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable