Accéder au contenu
Merck
Toutes les photos(5)

Principaux documents

SAB1404696

Sigma-Aldrich

Monoclonal Anti-MAPKAPK2 antibody produced in mouse

clone 3B8, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

MK2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
416,00 €

416,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μG
416,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

416,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3B8, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~35.57 kDa

Espèces réactives

human

Technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MAPKAPK2(9261)

Catégories apparentées

Description générale

Mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2) gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene. (provided by RefSeq)The gene is located on human chromosome 1q32.1. It consists of an autoinhibitory domain, a helix-turn-helix structure, which occupies the substrate binding cleft of the kinase domain and inhibits kinase function.

Immunogène

MAPKAPK2 (NP_116584, 266 a.a. ~ 352 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV

Actions biochimiques/physiologiques

Mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2) is involved in cytokine production and cell migration. Overexpression of MAPKAPK2 confers multiple myeloma (MM) resistance to chemotherapy. It phosphorylates the proteins found in the nucleus and cytoplasm. This protein confers gemcitabine sensitivity in pancreatic cancer cells. The protein is required for tumor necrosis factor (TNF) biosynthesis. It is linked to tumorigenesis and drug resistance. The protein functions as a prognostic marker for lung cancer.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

A functional copy-number variation in MAPKAPK2 predicts risk and prognosis of lung cancer
Liu B, et al.
American Journal of Human Genetics, 91(2), 384-390 (2012)
MK2-TNF-Signaling Comes Full Circle
Menon MB, et al.
Trends in Biochemical Sciences (2017)
The MAPK-activated protein kinase 2 mediates gemcitabine sensitivity in pancreatic cancer cells
Kopper F, et al.
Cell Cycle, 13(6), 884-889 (2014)
MAPKAPK2 (mitogen-activated protein kinase-activated protein kinase 2)
Felix R, et al.
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2011)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique