Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

SAB1404387

Sigma-Aldrich

Anti-β-Synuclein (SNCB) Antibody

mouse monoclonal, 3G6

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
416,00 €

416,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μG
416,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

416,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Nom du produit

Monoclonal Anti-SNCB antibody produced in mouse, clone 3G6, purified immunoglobulin, buffered aqueous solution

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3G6, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~40.85 kDa

Espèces réactives

human

Technique(s)

capture ELISA: suitable
immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SNCB(6620)

Description générale

β-Synuclein (SNCB) is present in the presynaptic neuron terminal. It comprises an imperfect KTKEGV sequence at the N-terminus as well as highly acidic and intrinsically disordered regions. SNCB shares sequence similarity with α-synuclein. The SNCB gene is mapped to human chromosome 5q35.2.

Immunogène

SNCB (AAH02902, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA

Actions biochimiques/physiologiques

β-Synuclein (SNCB) may delay the α- synuclein (αS) fibril formation and inhibit its aggregation. SNCB and αS interact with lipid vesicles to form a high degree of α-helical structure. SNCB is implicated in Dementia with Lewy bodies (DLB), a neurodegenerative dementia.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Andres Jerez et al.
Journal of clinical oncology : official journal of the American Society of Clinical Oncology, 30(12), 1343-1349 (2012-03-01)
Interstitial deletions of chromosome 5q are common in acute myeloid leukemia (AML) and myelodysplastic syndromes (MDS), pointing toward the pathogenic role of this region in disease phenotype and clonal evolution. The higher level of resolution of single-nucleotide polymorphism array (SNP-A)
Tracey Evans et al.
Brain research, 1681, 1-13 (2017-12-27)
Dementia with Lewy bodies (DLB) is the second most prevalent neurodegenerative dementia, where an accumulation of aggregated fibrillar alpha-synuclein in neurons of limbic and forebrain regions of the brain leads to visual hallucination, cognitive impairment of a fluctuating nature and
James W P Brown et al.
Scientific reports, 6, 36010-36010 (2016-11-04)
α-Synuclein is an intrinsically disordered protein that is associated with the pathogenesis of Parkinson's disease through the processes involved in the formation of amyloid fibrils. α and β-synuclein are homologous proteins found at comparable levels in presynaptic terminals but β-synuclein
Gina M Moriarty et al.
The Journal of biological chemistry, 292(39), 16368-16379 (2017-07-16)
α-Synuclein (αS) is the primary protein associated with Parkinson's disease, and it undergoes aggregation from its intrinsically disordered monomeric form to a cross-β fibrillar form. The closely related homolog β-synuclein (βS) is essentially fibril-resistant under cytoplasmic physiological conditions. Toxic gain-of-function

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique