Accéder au contenu
Merck
Toutes les photos(1)

Documents

SAB1401214

Sigma-Aldrich

Anti-IL12RB1 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

CD212, IL-12R-BETA1, IL12RB, MGC34454

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

western blot: 1 μg/mL

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... IL12RB1(3594)

Catégories apparentées

Description générale

IL12RB1 (interleukin 12 receptor subunit β1) gene is mapped to human chromosome 19p13.11. The encoded protein is a member of type I transmembrane receptors.
Rabbit polyclonal antibody raised against a full-length human IL12RB1 protein.

Immunogène

IL12RB1 (AAH29121.1, 1 a.a. ~ 381 a.a) full-length human protein.

Sequence
MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRRLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTDGMISAHCNLRLPDSRDSPASASRVAGITGICHHTRLILYF

Actions biochimiques/physiologiques

IL12RB1 (interleukin 12 receptor subunit β1) regulates the physiological responses to a number of diseases. IL12RB1 binds to both IL 12 (interleukin 12) and IL 23 (interleukin 23) at a common binding point 12p40-domain.Variation in the gene affects the receptor sensitivity towards the cytokines IL 12 and IL 23. Thus, the gene is associated with the diseases that are regulated by IL 12 and IL 23. Susceptibility to diseases such as tuberculosis, nontuberculous mycobacterial infection, malaria, cancer, pediatric asthma, and atopic dermatitis is related to IL12RB1.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

The introduction of RNA-DNA differences underlies interindividual variation in the human IL12RB1 mRNA repertoire.
Turner AJ
Proceedings of the National Academy of Sciences of the USA, 112(50), 15414-15419 (2015)
Diverse genome-wide association studies associate the IL12/IL23 pathway with Crohn Disease.
Wang K
American Journal of Human Genetics, 84(3), 399-405 (2009)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique