Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

SAB1401130

Sigma-Aldrich

Anti-FABP5 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

E-FABP, EFABP, PA-FABP, PAFABP

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
489,00 €

489,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μG
489,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

489,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Espèces réactives

mouse, human

Technique(s)

western blot: 1 μg/mL

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... FABP5(2171)

Description générale

This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. The human genome contains many pseudogenes similar to this locus. (provided by RefSeq)

Immunogène

FABP5 (NP_001435.1, 1 a.a. ~ 135 a.a) full-length human protein.

Sequence
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Actions biochimiques/physiologiques

FABPs (fatty acid-binding proteins) bind saturated and unsaturated long-chain fatty acids reversibly and might be involved in the transport of lipids to specific cellular compartments. FABP5 (fatty acid binding protein 5) serves as a transporter for endocannabinoid. FABP5 is also known as epidermal FABP (E-FABP) or mal1. FABP5 is significantly associated with the development of insulin resistance and atherosclerosis. This gene was found to be overexpressed in cervical cancer and it serves as an important biomarker for cervical cancer. In vitro study proves that FABP5 is necessary for cell proliferation, colony formation, cell migration, and invasion of cervical cancer. FABP5 is associated with cancer types such as bladder, pancreas, prostate, breast cancer and glioblastoma.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Fatty acid activated PPAR? promotes tumorigenicity of prostate cancer cells by up regulating VEGF via PPAR responsive elements of the promoter.
Forootan FS
Oncotarget, 7(8), 9322-9339 (2016)
FABP5 correlates with poor prognosis and promotes tumor cell growth and metastasis in cervical cancer.
Wang W
Tumour Biology : the Journal of the International Society For Oncodevelopmental Biology and Medicine, 37(11), 14873-14883 (2016)
The Antinociceptive Agent SBFI-26 Binds to Anandamide Transporters FABP5 and FABP7 at Two Different Sites.
Hsu HC
Biochemistry, 56(27), 3454-3462 (2017)
Transcriptome and Metabolome Analyses in Exogenous FABP4- and FABP5-Treated Adipose-Derived Stem Cells.
Yamamoto T
PLoS ONE, 11(12), 1-19 (2016)
Takuro Iwao et al.
PloS one, 18(2), e0281946-e0281946 (2023-02-17)
Nutrients are actively taken up by the brain via various transporters at the blood-brain barrier (BBB). A lack of specific nutrients in the aged brain, including decreased levels of docosahexaenoic acid (DHA), is associated with memory and cognitive dysfunction. To

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique