Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

SAB1400775

Sigma-Aldrich

Anti-CDCA5 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

Synonyme(s) :

Anti-MGC16386

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

50 μG
367,00 €

367,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
50 μG
367,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

367,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

mouse

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect immunofluorescence: suitable
western blot: 1 μg/mL

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CDCA5(113130)

Description générale

CDCA5 (cell division cycle associated 5) gene is mapped to human chromosome 11q13.1. The gene codes for the protein sororin. The protein is localized in the nucleus. It is known to be conserved among the vertebrates.

Immunogène

CDCA5 (NP_542399.1, 1 a.a. ~ 252 a.a) full-length human protein.

Sequence
MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE

Actions biochimiques/physiologiques

Sororin regulates proper cohesion and separation of sister chromatids during replication, by stabilizing cohesin on DNA. Phosphorylation of sororin by cyclin B during mitosis, reduces its potential to prevent Wap1 (cohesin release factor) and Pds5 (cohesin-interacting protein) binding.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Genomic alterations identified by array comparative genomic hybridization as prognostic markers in tamoxifen-treated estrogen receptor-positive breast cancer.
Han W
BMC Cancer, 6:92, 1-13 (2006)
Interaction of Sororin protein with polo-like kinase 1 mediates resolution of chromosomal arm cohesion.
Zhang N.
The Journal of Biological Chemistry, 286(48), 41826-41837 (2011)
C-terminus of Sororin interacts with SA2 and regulates sister chromatid cohesion.
Zhang N and Pati D
Cell Cycle, 14(6), 820-826 (2015)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique