Accéder au contenu
Merck
Toutes les photos(2)

Documents

OGS3299

Sigma-Aldrich

PSF-OXB20-NH2-TRX-TEV - N-TERMINAL TRX TAG BACTERIAL PLASMID

plasmid vector for molecular cloning

Synonyme(s) :

cloning vector, expression vector, molecular cloning vector, plasmid, plasmid vector, snapfast vector, vector

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352200
Nomenclature NACRES :
NA.85

Produit recombinant

expressed in E. coli

Étiquette/Marqueur

TRX tagged

Forme

buffered aqueous solution

Poids mol.

size 4205 bp

Sélection de bactéries

kanamycin

Origine de la réplication

pUC (500 copies)

Clivage des peptides

TEV

Localisation du marqueur peptidique

N-terminal

Promoteur

Promoter name: OXB20
Promoter activity: constitutive
Promoter type: bacterial

Gène reporter

none

Conditions d'expédition

ambient

Température de stockage

−20°C

Description générale

This plasmid is designed to express tagged proteins in E. coli. The plasmid contains a constitutive promoter (OXB20) derived from the region upstream of the E. coli RecA gene. It does not require induction or any additional components for activity. It is the strongest of the bacterial promoters that we provide and this high level of expression can cause expression problems with some proteins with poor solubility. For this reason we sell a range of bacterial promoters with different expression levels (OXB1(low)>OXB20(high)) that can be provided with the peptide tags in this plasmid on request.

About the Peptide Tag:This plasmid contains an n-terminal Thioredoxin (TRX) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is:SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGS.

About the Cleavage Tag:This plasmid also encodes a protease cleavage site that is designed to be positioned between your gene of interest and the tag to allow the removal of the tag following protein purification or isolation. This plasmid contains a TEV cleavage tag. The protein sequence of the cleavage tag is: ENLYFQG. Cleavage occurs between the Glu and Gly residues. TEV is often reported to have better specificity for its recognition site compared to EKT Thrombin or Faxtor Xa.

Promoter Expression Level: This plasmid contains a constitutive bacterial promoter that does not require induction. It is the strongest bacterial promoter we sell and this can cause solubility and expression problems with some proteins. We also offer a range of other bacterial promoters that are compatible with this plasmid and are available on request.

Séquence

To view sequence information for this product, please visit the product page

Remarque sur l'analyse

To view the Certificate of Analysis for this product, please visit www.oxgene.com

Produit(s) apparenté(s)

Réf. du produit
Description
Tarif

Code de la classe de stockage

12 - Non Combustible Liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Diana Romero et al.
Carcinogenesis, 37(1), 18-29 (2015-10-28)
Dickkopf-3 (Dkk-3) is a secreted protein whose expression is downregulated in many types of cancer. Endogenous Dkk-3 is required for formation of acini in 3D cultures of prostate epithelial cells, where it inhibits transforming growth factor (TGF)-β/Smad signaling. Here, we
Geoffrey M Lynn et al.
Nature biotechnology, 33(11), 1201-1210 (2015-10-27)
The efficacy of vaccine adjuvants such as Toll-like receptor agonists (TLRa) can be improved through formulation and delivery approaches. Here, we attached small molecule TLR-7/8a to polymer scaffolds (polymer-TLR-7/8a) and evaluated how different physicochemical properties of the TLR-7/8a and polymer
Jin-Gyoung Jung et al.
PLoS genetics, 10(10), e1004751-e1004751 (2014-10-31)
The Notch3 signaling pathway is thought to play a critical role in cancer development, as evidenced by the Notch3 amplification and rearrangement observed in human cancers. However, the molecular mechanism by which Notch3 signaling contributes to tumorigenesis is largely unknown.
Alexander C Cerny et al.
PLoS genetics, 11(10), e1005578-e1005578 (2015-10-29)
Recycling of signaling proteins is a common phenomenon in diverse signaling pathways. In photoreceptors of Drosophila, light absorption by rhodopsin triggers a phospholipase Cβ-mediated opening of the ion channels transient receptor potential (TRP) and TRP-like (TRPL) and generates the visual

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique