Accéder au contenu
Merck
Toutes les photos(5)

Principaux documents

HPA031149

Sigma-Aldrich

Anti-CD200 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-CD200 molecule, Anti-MOX1, Anti-MOX2, Anti-MRC, Anti-OX-2, Anti-ST1C1, Anti-SULT1C1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

Technique(s)

immunohistochemistry: 1:50- 1:200

Séquence immunogène

EREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRS

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... CD200(4345)

Description générale

CD200 (CD_antigen 200) gene is mapped to human chromosome 3q13.2. The gene encodes a transmembrane glycoprotein that belongs to the immunoglobulin superfamily. CD200 is widely expressed in different tissues and cell types such as lymphocytes, kidney glomeruli, neurons and endothelial cells. Its receptor is mainly expressed by myeloid cells (granulocytes, monocytes and macrophages).

Immunogène

CD200 molecule recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-CD200 antibody produced in rabbit has been used in immunofluorescence.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

Actions biochimiques/physiologiques

CD200 (CD_antigen 200) has an immunosuppressive effect on cells expressing its receptor, CD200R. CD200 is involved in maintaining immune homeostasis. CD200 reduces the immune system′s reaction to vaccines, while inhibition of CD200 expression can enhance the efficacy of cancer immunotherapy. The gene is known to be overexpressed in a number of human cancers. CD200 mostly supports tumor growth and invasion, by suppressing anti-tumor immune responses, while it is also known to inhibit melanoma cells from forming tumors or metastasizing into the lung. CD200 is considered as a biomarker in colon cancer and cutaneous squamous cell carcinoma. Deficiency of CD200 results in hyperactivation of macrophages and enhanced immune response to autoimmune disease.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST86190.

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Identification of CD200+ colorectal cancer stem cells and their gene expression profile.
Zhang SS
Oncology Reports, 36(4), 2252-2260 (2016)
A Truncated form of CD200 (CD200S) Expressed on Glioma Cells Prolonged Survival in a Rat Glioma Model by Induction of a Dendritic Cell-Like Phenotype in Tumor-Associated Macrophages.
Kobayashi K
Neoplasia, 18(4), 229-241 (2016)
Differential expression of CD200 in B-cell neoplasms by flow cytometry can assist in diagnosis, subclassification, and bone marrow staging.
Challagundla P
American Journal of Clinical Pathology, 142(6), 837-844 (2014)
Yoshinori Fukazawa et al.
Nature medicine, 21(2), 132-139 (2015-01-20)
Chronic-phase HIV and simian immunodeficiency virus (SIV) replication is reduced by as much as 10,000-fold in elite controllers (ECs) compared with typical progressors (TPs), but sufficient viral replication persists in EC tissues to allow viral sequence evolution and induce excess
Over-Expression of CD200 Predicts Poor Prognosis in Cutaneous Squamous Cell Carcinoma.
Li L
Medical Science Monitor : International Medical Journal of Experimental and Clinical Research, 22, 1079-1084 (2016)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique