Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

HPA030773

Sigma-Aldrich

Anti-VMP1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-EPG3, Anti-TANGO5, Anti-TMEM49

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Technique(s)

immunohistochemistry: 1:50- 1:200

Séquence immunogène

LYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAE

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TMEM49(81671)

Description générale

VMP1 (vacuole membrane protein 1) gene is mapped to human chromosome 17q23.1. VMP1 is a conserved multi-spanning transmembrane protein. The protein contains many endoplasmic reticulum micro-domains and six hydrophobic regions. It localizes to the intracellular membranes of the endoplasmic reticulum and the Golgi apparatus.

Immunogène

transmembrane protein 49 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Actions biochimiques/physiologiques

VMP1 (vacuole membrane protein 1) is associated with the process of tumor metastasis and is strongly involved in balancing apoptosis and autophagy. Depletion of VMP1 (vacuole membrane protein 1) in HeLa (immortal cell line) cells might inhibit autophagy. VMP1 might serve as a therapeutic target in human ovarian cancer, as its regulation is associated with the apoptosis and metastasis of ovarian cancer. Downregulation of VMP1 might reduce cancer cell growth and metastasis. VMP1 is considered as stress-inducible gene in organs affected by acute inflammatory responses. VMP1 is also known to support tight junction formation and cell-cell contacts by its interaction with Zonula Occludens-1 protein. The protein thus plays a role in maintaining the integrity and function of many membranous organelles in an evolutionarily conserved manner.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST86416

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Novel role of VMP1 as modifier of the pancreatic tumor cell response to chemotherapeutic drugs.
Gilabert M
Journal of Cellular Physiology, 228(9), 1834-1843 (2013)
Dysregulation of host cellular genes targeted by human papillomavirus (HPV) integration contributes to HPV-related cervical carcinogenesis.
Zhang R
International Journal of Cancer. Journal International Du Cancer, 138(5), 1163-1174 (2016)
Downregulation of VMP1 confers aggressive properties to colorectal cancer.
Guo XZ
Oncology Reports, 34(5), 2557-2566 (2015)
VMP1 Establishes ER-Microdomains that Regulate Membrane Contact Sites and Autophagy.
Tabara LC and Escalante R
PLoS ONE, 11(11), 1-20 (2016)
TMEM49-related apoptosis and metastasis in ovarian cancer and regulated cell death.
Zheng L
Molecular and Cellular Biochemistry, 416(1-2), 1-9 (2016)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique