Accéder au contenu
Merck
Toutes les photos(4)

Principaux documents

HPA020103

Sigma-Aldrich

Anti-MACC1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

Synonyme(s) :

Anti-SH3 domain-containing protein 7a5

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Technique(s)

immunohistochemistry: 1:50- 1:200

Séquence immunogène

FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQLSASNPF

Numéro d'accès UniProt

Application(s)

research pathology

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MACC1(346389)

Description générale

Metastasis associated in colon cancer 1 (MACC1) is an 852 amino acid protein with a Src-homology 3 (SH3)-domain and a motif which is rich in proline. The gene encoding it has been studied as an oncogene in a wide variety of carcinomas like that of the lung and liver. It is localized on human chromosome 7.

Immunogène

SH3 domain-containing protein 7a5 recombinant protein epitope signature tag (PrEST)

Application

Anti-MACC1 antibody produced in rabbit has been used in immunohistochemistry and immunoblotting.
Anti-MACC1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

Metastasis associated in colon cancer 1 (MACC1) functions as a regulator in the mitogen-activated protein kinase (MAPK) pathways in breast carcinoma. It is also involved in the pathways mediated by hepatocyte growth factor (HGF). MACC1 is associated with metastasis of colon cancer and it is useful as a biomarker for progression of many cancers, like gastric cancer.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST75105

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Ga-Eon Kim et al.
Analytical and quantitative cytopathology and histopathology, 37(2), 96-104 (2015-06-13)
To investigate whether metastasis associated in colon cancer 1 (MACC1) expression is a prognostic marker in breast cancer and to demonstrate the potential correlation between MACC1 and mitogen-activated protein kinase (MAPK) expression. Immunohistochemical staining with anti-MACC1 and phospho-p44/42 MAPK antibodies
MACC1 is post-transcriptionally regulated by miR-218 in colorectal cancer
Ilm K, et al.
Oncotarget, 7(33), 53443-53443 (2016)
Christoph Treese et al.
Cancers, 14(7) (2022-04-13)
Esophageal and Gastric Adenocarcinomas (AGE/S) are characterized by early metastasis and poor survival. MACC1 (Metastasis Associated in Colon Cancer 1) acts in colon cancer as a metastasis inducer and is linked to reduced survival. This project illuminates the role and
MACC1 regulates Fas mediated apoptosis through STAT1/3--Mcl-1 signaling in solid cancers
Radhakrishnan H, et al.
Cancer Letters, 403(33), 231-245 (2017)
Lijian Chen et al.
Journal of cancer research and therapeutics, 10(4), 1052-1056 (2015-01-13)
The clinical significance of metastasis associated in colon cancer 1 (MACC1), in human gallbladder cancer, is not yet established. This study was performed to assess the expression of MACC1 in benign and malignant gallbladder lesions, and to assess its clinicopathological

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique