Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

HPA005908

Sigma-Aldrich

Anti-UCHL5 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-UCH-L5, Anti-Ubiquitin C-terminal hydrolase UCH37, Anti-Ubiquitin carboxyl-terminal hydrolase isozyme L5, Anti-Ubiquitin thioesterase L5

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
540,00 €

540,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μL
540,00 €

About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

540,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Technique(s)

immunohistochemistry: 1:200- 1:500

Séquence immunogène

CTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKT

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... UCHL5(51377)

Description générale

Ubiquitin C-terminal hydrolase L5 (UCHL5), a cysteine protease,[1] is an integral part of the protein homeostasis network.[2] It belongs to the family of ubiquitin C-terminal hydrolases (UCHs).[1] UCHL5 is a proteasome-associated deubiquitinating enzyme[1], that is ubiquitously expressed in most of the normal human tissues.[2] UCHL5 gene is located on human chromosome 1q31.2.[2]

Immunogène

Ubiquitin carboxyl-terminal hydrolase isozyme L5 recombinant protein epitope signature tag (PrEST)

Application

Anti-UCHL5 antibody produced in rabbit has been used in immunohistochemistry(1:800).[1]

Actions biochimiques/physiologiques

Ubiquitin C-terminal hydrolase L5 (UCHL5) is considered a new prognostic marker in rectal cancer and pancreatic ductal adenocarcinoma.[1] UCHL5 along with Rpn13 plays a key role in maintaining the progression of cell-cycle and DNA replication. It is necessary for effective polyubiquitin removal from proteasomal substrates, which leads to proteasomal substrate breakdown. The absence of UCHL5 may also inhibit the degradation of specific substrates, resulting in apoptosis.[2]

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST70227

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Leena Arpalahti et al.
PloS one, 13(2), e0193125-e0193125 (2018-02-24)
Gastric cancer is the second most common cause of cancer-related mortality worldwide. Accurate prediction of disease progression is difficult, and new biomarkers for clinical use are essential. Recently, we reported that the proteasome-associated deubiquitinating enzyme UCHL5/Uch37 is a new prognostic
Shiho Fukui et al.
Oncotarget, 10(57), 5932-5948 (2019-11-02)
The ubiquitin-proteasome pathway plays an important role in the regulation of cellular proteins. As an alternative to the proteasome itself, recent research has focused on methods to modulate the regulation of deubiquitinating enzymes (DUBs) upstream of the proteasome, identifying DUBs
Leena Arpalahti et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 39(6), 1010428317710411-1010428317710411 (2017-06-28)
Pancreatic ductal adenocarcinoma is a lethal disease with an overall 5-year survival of less than 5%. Prognosis among surgically treated patients is difficult and identification of new biomarkers is essential for accurate prediction of patient outcome. As part of one
Leena Arpalahti et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 39(7), 1010428317716078-1010428317716078 (2017-07-07)
Colorectal cancer is among the three most common cancer types for both genders, with a rising global incidence. To date, prognostic evaluation is difficult and largely dependent on early detection and successful surgery. UCHL5/Uch37 is an integral part of the

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique