Accéder au contenu
Merck
Toutes les photos(5)

Documents

HPA003563

Sigma-Aldrich

Anti-C3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-ARMD9, Anti-C3a, Anti-C3b, Anti-CPAMD1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Technique(s)

immunohistochemistry: 1:200- 1:500

Séquence immunogène

QRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMS

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... C3(718)

Description générale

C3 (complement component 3) is the key component of the complement system. It is acted upon by C3 convertases, which produces the activated C3b. It is the predominant protein of the complement system, and is a member of the a2-macroglobulin protein family. It contains a reactive thioester bond, and α- and β-chains of 115 and 75kDa respectively. These together form 13 domains. These domains are divided into single linker (LNK), anaphylatoxin (ANA/C3a), C1r/C1s-UEGF-BMP1 (CUB), C345c, and thioester-containing domains (TED), and namely eight macroglobulin domains (MG1-MG8). The C3 gene is mapped to human chromosome 19p13.3.

Immunogène

Complement C3 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-C3 antibody produced in rabbit has been used in antibody bead arrays to target C3 protein.

Actions biochimiques/physiologiques

C3 (complement component 3) is the key component of the complement system. It is acted upon by C3 convertases, which produces anaphylatoxin C3a and the opsonin C3b. C3a is known to possess antifungal and antimicrobial activity and functions as a chemoattractant. It promotes inflammatory responses such as granule release, formation of oxygen radicals, initiates histamine release, smooth muscle contraction and induces vascular permeability. C3b stimulates opsonophagocytosis and is associated with the production of excess C3 convertases for C5 convertase generation. C3 might reduce the pathogenesis of rhodopsin mutations that leads to retinitis pigmentosa.
Complement component 3 is referred to as C3, ASP, C3a, C3b, AHUS5, ARMD9, CPAMD1 and HEL-S-62p. It is a key fluid-phase protein of the immune system. Complement activation of this gene results in the formation of multiple C3b plasma protein complexes in serum. It helps in recognizing and tags damaged plasma proteins for subsequent removal from the blood without triggering pro-inflammatory functions. The C3 serum levels are associated with ABI and angiographic parameters of atherosclerosis.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST78221

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Elizabeth Rodriguez et al.
The Journal of biological chemistry, 290(4), 2334-2350 (2014-12-10)
The solution structure of complement C3b is crucial for the understanding of complement activation and regulation. C3b is generated by the removal of C3a from C3. Hydrolysis of the C3 thioester produces C3u, an analog of C3b. C3b cleavage results
Genomic Characterization of LIGHT Reveals Linkage to an Immune Response Locus on Chromosome 19p13.3 and Distinct Isoforms Generated by Alternate Splicing or Proteolysis
Granger SW
Journal of Immunology, 167 (9), 5122-5128 (2001)
M Fehérvári et al.
International angiology : a journal of the International Union of Angiology, 33(1), 35-41 (2014-01-24)
Recent evidences show correlations between atherosclerosis and the serum level of third component of complement (C3). However, there is less data on the connection of C3 and the severity of atherosclerosis. The aim of our study was to evaluate the
The secreted Candida albicans protein Pra1 disrupts host defense by broadly targeting and blocking complement C3 and C3 activation fragments.
Luo S, et al.
Molecular Immunology, 93, 266-277 (2018)
Rhodopsin T17M Mutant Inhibits Complement C3 Secretion in Retinal Pigment Epithelium via ROS Induced Downregulation of TWIST1.
Xiong S, et al.
Journal of Cellular Biochemistry (2017)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique