Toutes les photos(12)

Documents

HPA000287

Anti-GPKOW antibody produced in rabbit

Name: Anti-GPKOW antibody produced in rabbit
Brand: SIGMA

Ab1, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-G patch domain and KOW motifs-containing protein antibody produced in rabbit, Anti-G patch domain-containing protein 5 antibody produced in rabbit, Anti-Protein MOS2 homolog antibody produced in rabbit, Anti-Protein T54 antibody produced in rabbit

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Toutes les photos(12)

About This Item

Code UNSPSC :

12352203

Numéro HPA (Human Protein Atlas):

HPA000287

Nomenclature NACRES :

NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies^® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

mouse, rat, human

Validation améliorée

independent
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

Séquence immunogène

ELQSVKPQEAPKELVIPLIQNGHRRQPPARPPGPSTDTGALADGVVSQAVKELIAESKKSLEERENAGVDPTLAIPMIQKGCTPSGEGADSEPRAETVPEEANYEA

Numéro d'accès UniProt

Q92917

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... GPKOW(27238)

Vous recherchez des produits similaires ? Visite Guide de comparaison des produits

Catégories apparentées

Anticorps à validation avancée

Description générale

G-patch (glycine-rich) domain and KOW (Kyrpides, Ouzounis and Woese) domain (GPKOW) is a RNA-binding protein that binds to RNA via pathway modulated by PKA (protein kinase A). It is present in human spliceosome. GPKOW is also known as T54 protein or modifier of snc 2 (MOS2) homolog, and it functions as an interaction partner for Cβ2 (C subunit of PKA). The gene is found to be located on human chromosome Xp11. GPKOW protein consists of one G-patch domain and two KOW motifs.

Immunogène

G patch domain and KOW motifs-containing protein recombinant protein epitope signature tag (PrEST)

Application

Anti-GPKOW antibody has been used in Western blotting. All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

G-patch (glycine-rich) domain and KOW (Kyrpides, Ouzounis and Woese) domain (GPKOW) plays a crucial role in both alternative splicing and miRNA processing. This RNA binding protein acts as a cofactor for DHX16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 protein) activity in the spliceosome. The encoded protein also helps in suppressing the splicing defect caused by mutation of DHX16 gene.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST74012

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

MOS2 has redundant function with its homolog MOS2H and is required for proper splicing of SNC1.

Charles Copeland et al.

Plant signaling & behavior, 8(9), doi:10-doi:10 (2013-06-28)

Plant immunity is essential for plant survival and resistance (R) proteins serve essential roles in pathogen detection and defense signal initiation. A gain-of-function mutation in SNC1, a TIR-type R gene, results in a characteristic autoimmune phenotype in Arabidopsis. From a

GPKOW is essential for pre-mRNA splicing in vitro and suppresses splicing defect caused by dominant-negative DHX16 mutation in vivo.

Shengbing Zang et al.

Bioscience reports, 34(6), e00163-e00163 (2014-10-09)

Human GPKOW [G-patch (glycine-rich) domain and KOW (Kyrpides, Ouzounis and Woese) domain] protein contains a G-patch domain and two KOW domains, and is a homologue of Arabidopsis MOS2 and Saccharomyces Spp2 protein. GPKOW is found in the human spliceosome, but

G-patch domain and KOW motifs-containing protein, GPKOW; a nuclear RNA-binding protein regulated by protein kinase A.

Anne Kristin Aksaas et al.

Journal of molecular signaling, 6, 10-10 (2011-09-02)

Post-transcriptional processing of pre-mRNA takes place in several steps and requires involvement of a number of RNA-binding proteins. How pre-mRNA processing is regulated is in large enigmatic. The catalytic (C) subunit of protein kinase A (PKA) is a serine/threonine kinase

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique