Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

AV54569

Sigma-Aldrich

Anti-EPB41L2 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Erythrocyte membrane protein band 4.1-like 2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

66 kDa

Espèces réactives

dog, rabbit, rat, bovine, horse, human, guinea pig, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... EPB41L2(2037)

Description générale

The gene EPB41L2 maps to human chromosome 6q23 and is widely expressed among human tissues. The gene encodes a 113-kDa protein that exhibits three regions of high homology to EPB41, including the membrane binding domain, the spectrin–actin binding domain, and the C-terminal domain.

Immunogène

Synthetic peptide directed towards the middle region of human EPB41L2

Application

Anti-EPB41L2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Actions biochimiques/physiologiques

The protein encoded by this gene interacts with the C-terminus of G protein-coupled receptors (GPCRs) and regulates intracellular distribution of the receptors, including parathyroid hormone.

Séquence

Synthetic peptide located within the following region: AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

M K Adwankar et al.
Neoplasma, 37(1), 31-36 (1990-01-01)
P388 mouse lymphocytic leukemia cells sensitive (P388/S) and resistant to adriamycin (P388/Adr), respectively, were exposed in vitro to 3 dose concentrations of adriamycin, mitoxantrone, vincristine and cisplatin in the presence and absence of extracellular Ca++ at 37 degrees C for
M Parra et al.
Genomics, 49(2), 298-306 (1998-05-23)
The prototypical erythrocyte membrane skeletal protein 4.1 (HGMW-approved symbol EPB41), here designated 4.1R, is encoded by a large, complexly spliced gene located on human chromosome 1p32-p33. In this paper we report evidence for a second 4.1 gene, 4.1G (HGMW-approved symbol

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique