Accéder au contenu
Merck
Toutes les photos(2)

Documents

AV53702

Sigma-Aldrich

Anti-FEM1B (AB1) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-DKFZp451E0710, Anti-FIAA, Anti-Fem-1 homolog b (C. elegans)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

69 kDa

Espèces réactives

bovine, dog, horse, guinea pig, human, rat

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_056137

Numéro d'accès UniProt

Q9UK73

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... FEM1B(10116)

Immunogène

Synthetic peptide directed towards the middle region of human FEM1B

Application

Anti-FEM1B (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Actions biochimiques/physiologiques

FEM1B [fem-1 homolog b (C. elegans)] gene encodes a protein which is a homolog of feminization-1 (FEM-1), a protein involved in the sex-determination pathway of the nematode Caenorhabditis elegans. It stimulates ubiquitylation of Gli1 as well as inhibits its transcriptional activity. It is a proapoptotic protein that facilitates proteasome inhibitor-induced apoptosis of human colon cancer cells. Additionally, FEM1B serves as an adapter or mediator protein that links CHK1 and Rad9 and facilitates checkpoint signaling induced by replication stress.

Séquence

Synthetic peptide located within the following region: FQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Andrew S Gilder et al.
Biochemical and biophysical research communications, 440(3), 431-436 (2013-10-01)
The mammalian Fem1b gene encodes a homolog of FEM-1, a protein in the sex-determination pathway of the nematode Caenorhabditis elegans. Fem1b and FEM-1 proteins each contain a VHL-box motif that mediates their interaction with certain E3 ubiquitin ligase complexes. In
M Cecilia Subauste et al.
Molecular carcinogenesis, 49(2), 105-113 (2009-11-13)
In the treatment of colon cancer, the development of resistance to apoptosis is a major factor in resistance to therapy. New molecular approaches to overcome apoptosis resistance, such as selectively upregulating proapoptotic proteins, are needed in colon cancer therapy. In
T-P Sun et al.
Oncogene, 28(18), 1971-1981 (2009-03-31)
Human checkpoint kinase 1 (CHK1) is an essential kinase required to preserve genome stability, and is activated by DNA replication blockage through the ataxia-telangiectasia-mutated-and-Rad3-related (ATR)/ATRIP-signaling pathway. In this report, we show that a novel CHK1-interacting protein, FEM1B (human homologue of

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique