Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

AV51761

Sigma-Aldrich

Anti-CYP1B1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-CP1B, Anti-Cytochrome P450, family 1, subfamily B, polypeptide 1, Anti-GLC3A

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

lyophilized powder

Poids mol.

61 kDa

Espèces réactives

mouse, guinea pig, horse, human, canine, rat, rabbit

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_000095

Numéro d'accès UniProt

Q16678

Température de stockage

−20°C

Informations sur le gène

human ... CYP1B1(1545)

Immunogène

The immunogen for anti-CYP1B1 antibody: synthetic peptide derected towards the middle region of human CYP1B1

Application

Anti-CYP1B1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Actions biochimiques/physiologiques

Cytochrome P450, family 1, subfamily B, polypeptide 1 (CYP1B1) is a member of cytochrome P450 superfamily of monooxygenases. CYP1B1 is localized to the endoplasmic reticulum. It metabolizes polycyclic aromatic hydrocarbon and 17β-estradiol and is possibly involved in the metabolism of signaling molecule involved in the development of the eye. Mutations in CYP1B1 are associated with primary congenital glaucoma and congenital anterior staphylomas.

Séquence

Synthetic peptide located within the following region: AVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQY

Forme physique

Lyophilized from PBS buffer with 2% sucrose

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

12 - Non Combustible Liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number
QC31588
QC20986

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Rechercher un(e) COA

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Milana Kokosar et al.
Scientific reports, 6, 22883-22883 (2016-03-16)
Genetic and epigenetic factors may predispose women to polycystic ovary syndrome (PCOS), a common heritable disorder of unclear etiology. Here we investigated differences in genome-wide gene expression and DNA methylation in adipose tissue from 64 women with PCOS and 30
Ramzi Al Judaibi et al.
Clinical ophthalmology (Auckland, N.Z.), 8, 445-448 (2014-03-05)
Here, we present two patients with congenital anterior staphyloma, with mutations in the CYP1B1 gene. We reviewed the medical records, including the genetic analysis. Two unrelated patients presented with congenital anterior staphylomas. Both patients showed mutations in the CYP1B1 gene.
Douglas B Gould et al.
The International journal of developmental biology, 48(8-9), 1015-1029 (2004-11-24)
Development of the ocular anterior segment involves a series of inductive interactions between neural ectoderm, surface ectoderm and periocular mesenchyme. The timing of these events is well established but less is known about the molecular mechanisms involved. Various genes that
The nuclear vitamin D receptor: biological and molecular regulatory properties revealed.
M R Haussler et al.
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research, 13(3), 325-349 (1998-04-03)
Xueli Chen et al.
The British journal of ophthalmology, 98(2), 246-251 (2013-11-15)
The aim of the present work was to investigate CYP1B1 gene mutations in patients of Han Chinese ethnicity with primary congenital glaucoma (PCG), and explore the clinical characteristics associated with operative effects. Peripheral blood genomic DNA was extracted from patients
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique