AV50505
Anti-AIM2 antibody produced in rabbit
affinity isolated antibody
Synonyme(s) :
Anti-Absent in melanoma 2, Anti-PYHIN4
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Source biologique
rabbit
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
39 kDa
Espèces réactives
human, horse
Concentration
0.5 mg - 1 mg/mL
Technique(s)
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... AIM2(9447)
Description générale
The gene AIM2 (Absent in melanoma 2) is mapped to human chromosome 1q22. It belongs to the IFI20X /IFI16 family. AIM2 transcripts are detected in spleen, small intestine, testis and peripheral blood leukocytes.
Immunogène
Synthetic peptide directed towards the N terminal region of human AIM2
Application
Anti-AIM2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Actions biochimiques/physiologiques
Absent in melanoma 2 (AIM2) is induced by IFN-γ. The probable roles of AIM2 are regulation of cell proliferation, inflammation and benign prostate hyperplasia. It also suppresses proliferation and tumorigenicity of human breast cancer cells. AIM2 is a suppressor of melanoma tumorigenicity. AIM2 is up-regulated in humans with hepatitis B virus-associated glomerulonephritis. AIM2 expression was positively correlated with caspase-1 and IL (Interleukin)-1β expression. AIM2 is also a component of inflammasome and can sense cytoplasmic DNA, causing activation of ASC (apoptosis-associated speck-like protein containing a CARD) pyroptosome and caspase-1.
Séquence
Synthetic peptide located within the following region: ESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATL
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
12 - Non Combustible Liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Larissa Ponomareva et al.
Molecular cancer research : MCR, 11(10), 1193-1202 (2013-07-19)
Close links have been noted between chronic inflammation of the prostate and the development of human prostatic diseases such as benign prostate hyperplasia (BPH) and prostate cancer. However, the molecular mechanisms that contribute to prostatic inflammation remain largely unexplored. Recent
Junhui Zhen et al.
Mediators of inflammation, 2014, 190860-190860 (2014-04-05)
AIM2 plays an important role in innate immunity, but its role in regulating the immune response to hepatitis B virus (HBV) is unknown. We hypothesized that AIM2 expression is positively correlated with HBV-mediated inflammation in patients with HBV-associated glomerulonephritis (HBV-GN)
I-Fen Chen et al.
Molecular cancer therapeutics, 5(1), 1-7 (2006-01-25)
IFN-inducible proteins are known to mediate IFN-directed antitumor effects. The human IFN-inducible protein absent in melanoma 2 (AIM2) gene encodes a 39-kDa protein, which contains a 200-amino-acid repeat as a signature of HIN-200 family (hematopoietic IFN-inducible nuclear proteins). Although AIM2
K L DeYoung et al.
Oncogene, 15(4), 453-457 (1997-07-24)
Chromosome 6-mediated suppression of tumorigenicity in malignant melanoma cell lines provides a model system to identify genes associated with the reversion of the tumorigenic phenotype. Using subtractive cDNA selection, we recently identified a series of novel genes which are differentially
Teresa Fernandes-Alnemri et al.
Nature, 458(7237), 509-513 (2009-01-23)
Host- and pathogen-associated cytoplasmic double-stranded DNA triggers the activation of a NALP3 (also known as cryopyrin and NLRP3)-independent inflammasome, which activates caspase-1 leading to maturation of pro-interleukin-1beta and inflammation. The nature of the cytoplasmic-DNA-sensing inflammasome is currently unknown. Here we
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique