AV49458
Anti-TRPV5 antibody produced in rabbit
affinity isolated antibody
Synonyme(s) :
Anti-CAT2, Anti-ECAC1, Anti-OTRPC3, Anti-Transient receptor potential cation channel, subfamily V, member 5
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
82 kDa
Espèces réactives
human
Concentration
0.5 mg - 1 mg/mL
Technique(s)
immunohistochemistry: suitable
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... TRPV5(56302)
Description générale
Transient receptor potential cation channel, subfamily V, member 5 (TRPV5) belongs to transient receptor potential (TRP) cation channels family. All TRP channels contain transmembrane helices and CaM (calmodulin) binding sites. TRPV5 is highly expressed in kidney, small intestine and pancreas. Low levels of TRPV5 are observed in testis, prostate, placenta, brain, colon and rectum. TRPV5 has also been reported in human parathyroid glands.[1] The protein mianly localizes at the plasma membrane.
Immunogène
Synthetic peptide directed towards the N terminal region of human TRPV5
Application
Anti-TRPV5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Actions biochimiques/physiologiques
Transient receptor potential cation channel, subfamily V, member 5 (TRPV5) is an epithelial transmembrane calcium-selective channel. TRPV5 mediates renal calcium reabsorption[2] and mutations in this gene result in hypercalciuria.[3] TRPV5 also controls levels of cadmium and zinc in cells. WNK3, the With No Lysine (K) family membre, positively regulate TRPV5.
Séquence
Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
12 - Non Combustible Liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Faites votre choix parmi les versions les plus récentes :
Certificats d'analyse (COA)
Lot/Batch Number
Vous ne trouvez pas la bonne version ?
Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Laura Giusti et al.
Journal of cellular and molecular medicine, 18(10), 1944-1952 (2014-08-29)
The parathyroid glands play an overall regulatory role in the systemic calcium (Ca(2+)) homeostasis. The purpose of the present study was to demonstrate the presence of the Ca(2+) channels transient receptor potential vanilloid (TRPV) 5 and TRPV6 in human parathyroid
Gergely Kovacs et al.
Cell calcium, 54(4), 276-286 (2013-08-24)
TRPV5 and TRPV6 are two major calcium transport pathways in the human body maintaining calcium homeostasis. TRPV5 is mainly expressed in the distal convoluted and connecting tubule where it is the major, regulated pathway for calcium reabsorption. TRPV6 serves as
D Müller et al.
Genomics, 67(1), 48-53 (2000-08-17)
Functional and morphological analyses indicated that the epithelial Ca2+ channel (ECaC), which was recently cloned from rabbit kidney, exhibits the defining properties for being the gatekeeper in transcellular Ca2+ (re)absorption. Its human homologue provides, therefore, a molecular basis for achieving
Zhaohua Guo et al.
PloS one, 8(2), e58174-e58174 (2013-03-08)
TRPML3 and TRPV5 are members of the mucolipin (TRPML) and TRPV subfamilies of transient receptor potential (TRP) cation channels. Based on sequence similarities of the pore forming regions and on structure-function evidence, we hypothesized that the pore forming domains of
Olena Andrukhova et al.
The EMBO journal, 33(3), 229-246 (2014-01-18)
αKlotho is thought to activate the epithelial calcium channel Transient Receptor Potential Vanilloid-5 (TRPV5) in distal renal tubules through its putative glucuronidase/sialidase activity, thereby preventing renal calcium loss. However, αKlotho also functions as the obligatory co-receptor for fibroblast growth factor-23
Active Filters
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique
