Accéder au contenu
Merck
Toutes les photos(3)

Documents

AV46788

Sigma-Aldrich

Anti-LMAN2 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-C5orf8, Anti-GP36B, Anti-Lectin, mannose-binding 2, Anti-VIP36

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

36 kDa

Espèces réactives

human, bovine, rabbit, rat, mouse, dog, horse, guinea pig

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... LMAN2(10960)

Catégories apparentées

Description générale

Lectin, mannose-binding 2 (LMAN2, VIP36) is an intracellular, integral membrane protein that functions as a lectin of the post-Golgi secretory pathway. LMAN2 facilitates the secretion of high mannose glycoproteins predominantly via the apical surface of cells.

Spécificité

Anti-LMAN2 (AB1) polyclonal antibody reacts with zebrafish, bovine, human, rat, canine, and mouse lectin, mannose-binding 2 proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human LMAN2

Application

Anti-LMAN2 (AB1) polyclonal antibody is used to tag lectin, mannose-binding 2 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of lectin, mannose-binding 2 in the secretion of high mannose glycoproteins.

Actions biochimiques/physiologiques

LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.

Séquence

Synthetic peptide located within the following region: SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Arivusudar Marimuthu et al.
Proteomics. Clinical applications, 7(5-6), 355-366 (2012-11-20)
Gastric cancer is a commonly occurring cancer in Asia and one of the leading causes of cancer deaths. However, there is no reliable blood-based screening test for this cancer. Identifying proteins secreted from tumor cells could lead to the discovery

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique