AV45470

Anti-ZP2 antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-ZPA, Anti-Zona pellucida glycoprotein 2 (sperm receptor)
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 68 kDa
• Espèces réactives: human
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_003451
• Numéro d'accès UniProt: Q05996
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: human ... ZP2(7783)

Description

Immunogène

Synthetic peptide directed towards the C terminal region of human ZP2

Application

Anti-ZP2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Actions biochimiques/physiologiques

Zona pellucida glycoprotein 2 (ZP2; ZPA; sperm receptor) is a glycoprotein that is present in zona pellucida, the extracellular matrix that surrounds oocyte and the early embryo. ZP2 mediates the binding of the sperm to zona pellucida and its penetration.[1][2]

Séquence

Synthetic peptide located within the following region: PDSFPQWNVVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAFVS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable