Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

AV44970

Sigma-Aldrich

Anti-CLCC1 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Chloride channel CLIC-like 1, Anti-KIAA0761, Anti-MCLC, Anti-RP11-475E11.6

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
325,00 €

325,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μL
325,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

325,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

61 kDa

Espèces réactives

dog, human, rabbit, mouse, pig, rat, bovine

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... CLCC1(23155)

Immunogène

Synthetic peptide directed towards the N terminal region of human CLCC1

Application

Anti-CLCC1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Actions biochimiques/physiologiques

Chloride channel CLIC-like 1 (CLCC1; Mid-1 related chloride channel, MCLC) belongs to the family of chloride channels present at the plasma membrane and membranes of intracellular compartments. They are involved in the regulation of cell volume and acidification of intracellular compartments. Chloride channels may modulate cell growth and apoptosis.[1] CLCC1 is expressed in membranes of endoplasmic reticulum, Golgi apparatus, and nucleus.[2]

Séquence

Synthetic peptide located within the following region: MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Xinhua Li et al.
Annual review of physiology, 64, 609-633 (2002-02-05)
Hepatocytes possess chloride channels at the plasma membrane and in multiple intracellular compartments. These channels are required for cell volume regulation and acidification of intracellular organelles. Evidence also supports a role of chloride channels in modulation of apoptosis and cell
M Nagasawa et al.
The Journal of biological chemistry, 276(23), 20413-20418 (2001-03-30)
MID-1 is a Saccharomyces cerevisiae gene encoding a stretch-activated channel. Using MID-1 as a molecular probe, we isolated rat cDNA encoding a protein with four putative transmembrane domains. This gene encoded a protein of 541 amino acids. We also cloned

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique