Accéder au contenu
Merck
Toutes les photos(6)

Principaux documents

AV43931

Sigma-Aldrich

Anti-SLC39A6 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-LIV-1, Anti-Solute carrier family 39 (Zinc transporter), member 6

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
385,00 €

385,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μL
385,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

385,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

48 kDa

Espèces réactives

human, mouse, rat, sheep, horse, dog, bovine, rabbit

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SLC39A6(25800)

Description générale

Solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 (SLC39A6, LIV1, ZIP6) is a mediator of zinc (Zn2+) transport and intracellular zinc homeostasis. SLC39A6/LIV1 is involves in important processes such as epithelial-to-mesenchymal transition (EMT) in human pancreatic, breast, and prostate cancer cells. SLC39A6/LIV1 has been shown to be a critical mediator responsible for HDACi-induced apoptosis.

Spécificité

Anti-SLC39A6 polyclonal antibody reacts with bovine, canine, human, mouse, and rat solute carrier family 39 (Zinc transporter), member 6 proteins.

Immunogène

Synthetic peptide directed towards the middle region of human SLC39A6

Application

Anti-SLC39A6 polyclonal antibody is used to tag solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 39 (Zinc transporter), member 6/zinc transporter 6 in intracellular zinc homeostasis, epithelial-to-mesenchymal transition (EMT) in cancer cells, and in HDACi-induced apoptosis.

Actions biochimiques/physiologiques

Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.

Séquence

Synthetic peptide located within the following region: RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique