Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

AV43861

Sigma-Aldrich

Anti-SLC25A14 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Solute carrier family 25 (mitochondrial carrier, brain), member 14

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
325,00 €

325,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μL
325,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

325,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

21 kDa

Espèces réactives

rat, rabbit, dog, mouse, bovine, human, horse, sheep, guinea pig

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SLC25A14(9016)

Immunogène

Synthetic peptide directed towards the N terminal region of human SLC25A14

Application

Anti-SLC25A14 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Actions biochimiques/physiologiques

SLC25A14 is a mitochondrial uncoupling protein (UCP) belonging to the family of mitochondrial anion carrier proteins (MACP). The UCPs mediate the transfer of anions from inner to outer mitochondrial membrane and transfer of protons in the reverse direction. Altered expression of SLC25A14 gene has been observed in autism spectrum disorders and in cardiovascular disorders.

Séquence

Synthetic peptide located within the following region: SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Chuanhui Dong et al.
PloS one, 6(11), e27157-e27157 (2011-11-17)
Sirtuins (SIRTs) and mitochondrial uncoupling proteins (UCPs) have been implicated in cardiovascular diseases through the control of reactive oxygen species production. This study sought to investigate the association between genetic variants in the SIRT and UCP genes and carotid plaque.
David B Ramsden et al.
Brain and behavior, 2(4), 468-478 (2012-09-06)
Uncoupling proteins (UCPs) belong to a large family of mitochondrial solute carriers 25 (SLC25s) localized at the inner mitochondrial membrane. UCPs transport protons directly from the intermembrane space to the matrix. Of five structural homologues (UCP1 to 5), UCP4 and
Ayyappan Anitha et al.
Molecular autism, 3(1), 12-12 (2012-11-03)
Mitochondrial dysfunction (MtD) has been observed in approximately five percent of children with autism spectrum disorders (ASD). MtD could impair highly energy-dependent processes such as neurodevelopment, thereby contributing to autism. Most of the previous studies of MtD in autism have

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique