AV42287

Anti-FST antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-FS, Anti-Follistatin
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 35 kDa
• Espèces réactives: sheep, goat, rat, dog, mouse, human, horse, rabbit, guinea pig, bovine
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_006341
• Numéro d'accès UniProt: Q6FHE1
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... FST(10468)

Description

Description générale

Follistatin is an autocrine glycoprotein component of the inhibin-activin-follistatin axis that mediates many cellular processes via its ability to bind and neutralize members of the TGF-β superfamily such as activin and myostatin/GDF-8.

Spécificité

Anti-FST polyclonal antibody reacts with canine, chicken, bovine, pig, human, mouse, rat, and zebrafish follistatin proteins.

Immunogène

Synthetic peptide directed towards the C terminal region of human FST

Application

Anti-FST polyclonal antibody is used to tag follistatin protein for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of follistatin in the regulation of TGF-β superfamily mediated processes such as those regulated by myostatin/GDF8 and activin.

Actions biochimiques/physiologiques

Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release.Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.

Séquence

Synthetic peptide located within the following region: SLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable