Accéder au contenu
Merck
Toutes les photos(3)

Documents

AV40185

Sigma-Aldrich

Anti-PRMT5 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Protein arginine methyltransferase 5

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

68 kDa

Espèces réactives

rat, horse, guinea pig, rabbit, mouse, human, dog

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PRMT5(10419)

Immunogène

Synthetic peptide directed towards the N terminal region of human PRMT5

Actions biochimiques/physiologiques

PRMT5 methylates specific arginine residues in the small nuclear ribonucleoproteins Sm D1 and Sm D3 to monomethylarginine and to symmetrical dimethylarginines (sDMAs). It methylates SUPT5H. PRMT5 plays a role in the assembly of snRNP core particles and may play a role in cytokine-activated transduction pathways. It negatively regulates cyclin E1 promoter activity and cellular proliferation and May regulate the SUPT5H transcriptional elongation properties. It may be part of a pathway that is connected to a chloride current, possibly through cytoskeletal rearrangement. PRMT5 methylates histone H2A/H4 ′Arg-3′ during germ cell development and methylates histone H3 ′Arg-8′, which may repress transcription.

Séquence

Synthetic peptide located within the following region: FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique