Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

AV37665

Sigma-Aldrich

Anti-GPC3 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Glypican 3

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

lyophilized powder

Poids mol.

64 kDa

Espèces réactives

guinea pig, horse, canine, rat, mouse, rabbit, bovine, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Température de stockage

−20°C

Informations sur le gène

human ... GPC3(2719)

Description générale

Glypican 3 (GPC3), whose gene is associated with Simpson-Golabi-Behmel syndrome, is a heparin sulfate proteoglycan that is anchored to cell-surfaces via glycosylphosphatidylinositol (GPI). Overexpression of glypican 3 occurs in hepatocellular carcinomas (HCC). The silencing of glypican 3 expression leads to apoptosis in HCC.

Spécificité

Anti-GPC3 polyclonal antibody reacts with canine, bovine, human, mouse, and rat glypican 3 proteins.

Immunogène

The immunogen for anti-GPC3 antibody: synthetic peptide derected towards the middle region of human GPC3

Application

Anti-GPC3 polyclonal antibody is used to tag glypican 3 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe in cancer diagnosis to detect the presence of glypican 3 in hepatocellular carcinomas (HCC).

Séquence

Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL

Forme physique

Lyophilized from PBS buffer with 2% sucrose

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

12 - Non Combustible Liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique