Accéder au contenu
Merck
Toutes les photos(2)

Documents

AV32053

Sigma-Aldrich

Anti-NPAS1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Neuronal PAS domain protein 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

63 kDa

Espèces réactives

rabbit, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_002508

Numéro d'accès UniProt

Q99742

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... NPAS1(4861)

Catégories apparentées

Description générale

NPAS1 is a basic helix-loop-helix transcription factor that that regulates branching morphogenesis in mouse embryonic lung tissues. Studies in mice have reported that NPAS1 deficiency can result in behavioural and functional abnormalities.
Rabbit Anti-NPAS1 antibody recognizes human, mouse, and rat NPAS1.

Immunogène

Synthetic peptide directed towards the C terminal region of human NPAS1

Application

Rabbit Anti-NPAS1 antibody can be used for western blotting at 2μg/ml. It can also be used for IHC at 4-8μg/ml, using paraffin-embedded tissues.

Actions biochimiques/physiologiques

NPAS1 is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. Studies of a related mouse gene suggest that it functions in neurons. The exact function of this gene is unclear, but it may play protective or modulatory roles during late embryogenesis and postnatal development.

Séquence

Synthetic peptide located within the following region: TIRYGPAELGLVYPHLQRLGPGPALPEAFYPPLGLPYPGPAGTRLPRKGD

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Bernadette M Levesque et al.
American journal of respiratory cell and molecular biology, 36(4), 427-434 (2006-11-18)
Drosophila trachealess (Trl), master regulator of tracheogenesis, has no known functional mammalian homolog. We hypothesized that genes similar to trachealess regulate lung development. Quantitative (Q)RT-PCR and immunostaining were used to determine spatial and temporal patterns of npas1 gene expression in
Claudia Erbel-Sieler et al.
Proceedings of the National Academy of Sciences of the United States of America, 101(37), 13648-13653 (2004-09-07)
Laboratory mice bearing inactivating mutations in the genes encoding the NPAS1 and NPAS3 transcription factors have been shown to exhibit a spectrum of behavioral and neurochemical abnormalities. Behavioral abnormalities included diminished startle response, as measured by prepulse inhibition, and impaired

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique