AV31438

Anti-GTF2H3 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-General transcription factor IIH, polypeptide 3, 34 kDa
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 34 kDa
• Espèces réactives: rat, human, mouse, rabbit, pig, horse
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): immunohistochemistry: suitable; western blot: suitable
• Numéro d'accès NCBI: NP_001507
• Numéro d'accès UniProt: Q13889
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... GTF2H3(2967)

Description

Description générale

GTF2H3 belongs to the TFB4 family of transcription factors and forms a part of the TFIIH complex. GTF2H3 regulates nucleotide excision repair and RNA polymerase II-mediated transcription.
Rabbit Anti-GTF2H3 antibody recognizes bovine, human, mouse, and rat GTF2H3.

Immunogène

Synthetic peptide directed towards the N terminal region of human GTF2H3

Application

Rabbit Anti-GTF2H3 antibody can be used for western blot (2μg/ml) and immunohistochemistry (4-8μg/ml) assays.

Actions biochimiques/physiologiques

GTranscription Factor Antibodies2H3 interacts with HIV-1 Tat as a component of the HIV-1 transcription pre-initiation complex, but is released from the elongation complex which includes P-TEFb. It synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter.

Séquence

Synthetic peptide located within the following region: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable