Accéder au contenu
Merck
Toutes les photos(3)

Key Documents

AV31433

Sigma-Aldrich

Anti-POU6F1 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-POU domain, class 6, transcription factor 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(3)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

33 kDa

Espèces réactives

rabbit, bovine, mouse, horse, rat, human, dog

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_002693

Numéro d'accès UniProt

Q14863

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... POU6F1(5463)

Description générale

POU6F1 is a POU homeobox containing transcription factor that represses Oct2A-mediated stimulation. POU6F1 has been implicated in cell proliferation and ovarian adenocarcinoma.
Rabbit Anti-POU6F1 (AB1) recognizes human, mouse, rat, canine, zebrafish, and bovine POU6F1

Immunogène

Synthetic peptide directed towards the middle region of human POU6F1

Application

Rabbit Anti-POU6F1 (AB1) antibody can be used for immunohistochemistry (4-8μg/ml) and western blot (0.12μg/ml) applications.

Actions biochimiques/physiologiques

The POU6F1 gene encodes a protein that is part of a family of transcription factors which exhibit distinct temporal and spatial patterns of expression.

Séquence

Synthetic peptide located within the following region: YFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

E Wey et al.
Biochemical and biophysical research communications, 220(2), 274-279 (1996-03-18)
Transcription factors of the POU family recognize DNA through their POU domain which represents a bipartite DNA binding motif consisting of a POU specific domain and a POU homeobox. It is thought that both subdomains make specific contacts with DNA
Norihito Yoshioka et al.
Human cell, 22(4), 94-100 (2009-10-31)
Clear cell adenocarcinoma of the ovary often shows resistance to anticancer agents. We investigated new molecules to use when developing molecular-targeting therapy for clear cell adenocarcinoma of the ovary. RMG-I cells without invasive potential and RMG-V cells with invasive potential

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique