Accéder au contenu
Merck
Toutes les photos(1)

Documents

AV09001

Sigma-Aldrich

Anti-DOK1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Docking protein 1, 62 kDa (downstream of tyrosine kinase 1), Anti-MGC117395, Anti-MGC138860, Anti-P62DOK

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

53 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_001372

Numéro d'accès UniProt

Q99704

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... DOK1(1796)

Immunogène

Synthetic peptide directed towards the C terminal region of human DOK1

Application

Anti-DOK1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.

Actions biochimiques/physiologiques

DOK1 is a tumor suppressor protein that is repressed by hypermethylation in a variety of human tumors. DOK1 transcription is regulated by E2F1 transcription factor and is important during cellular stress and etoposide-induced DNA damage. DOK1 is the critical mediator of stress-induced cell death. Inactivation of DOK1 is a frequent feature in head and neck cancers.

Séquence

Synthetic peptide located within the following region: EPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Maha Siouda et al.
Molecular and cellular biology, 32(23), 4877-4890 (2012-10-03)
The expression of the tumor suppressor DOK1 is repressed in a variety of human tumors as a result of hypermethylation of its promoter region. However, the molecular mechanisms by which DOK1 expression is regulated have been poorly investigated. Here, we
Amandine Saulnier et al.
International journal of cancer, 130(11), 2484-2494 (2011-07-29)
The DOK1 gene is a putative tumour suppressor gene located on the human chromosome 2p13 which is frequently rearranged in leukaemia and other human tumours. We previously reported that the DOK1 gene can be mutated and its expression down-regulated in

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique