Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

MAB2290

Sigma-Aldrich

Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3

clone 29A3, Chemicon®, from mouse

Synonyme(s) :

CD49c

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
509,00 €

509,00 €


Date d'expédition estimée le27 février 2025Détails

Un anticorps recombinant, sans conservateur, est disponible pour votre cible. Essayez ZRB1389

Devis pour commande en gros

Sélectionner une taille de conditionnement

Changer de vue
100 μG
509,00 €

About This Item

Code UNSPSC :
12352203
eCl@ss :
32160702
Nomenclature NACRES :
NA.41

509,00 €


Date d'expédition estimée le27 février 2025Détails

Un anticorps recombinant, sans conservateur, est disponible pour votre cible. Essayez ZRB1389

Devis pour commande en gros

Source biologique

mouse

Niveau de qualité

Forme d'anticorps

purified antibody

Type de produit anticorps

primary antibodies

Clone

29A3, monoclonal

Espèces réactives

human

Fabricant/nom de marque

Chemicon®

Technique(s)

immunocytochemistry: suitable
immunohistochemistry: suitable
western blot: suitable

Isotype

IgG1

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ITGA3(3675)

Description générale

MAB2290 is a mouse monoclonal generated to a synthetic peptide in the cytoplasmic domain of integrin alpha 3A.

Spécificité

Anti-integrin alpha 3A (MAB2290) recognizes specifically the cytoplasmic domain of integrin subunit alpha 3A which is present in the basal layer in skin, glomeruli, Bowman′s capsules and distal tubuli in kidney, all vascular and capillary endothlia in brain, heart, and skin, and vascular smooth muscle cells in heart.

SPECIES REACTIVITIES:

Although untested, a braod range of species reactivity is expected due to the conserved nature of the epitope.

Immunogène

Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha 3A including an additional N-terminal cysteine: CRTRALYEAKRQKAEMKSQPSETERLTDDY

Application

Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 is an antibody against Integrin α3 for use in WB, IC, IH.
Western Blot

Immunocytochemistry

Immunohistochemistry (Frozen Sections)

Optimal working dilutions must be determined by the end user.

Forme physique

Format: Purified
Purified. Liquid in PBS containing 0.01% sodium azide.

Autres remarques

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Informations légales

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

12 - Non Combustible Liquids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Frédéric Dallaire et al.
Journal of virology, 83(11), 5329-5338 (2009-03-20)
The human adenovirus E4orf6 and E1B55K proteins promote viral replication by targeting several cellular proteins for degradation. The E4orf6 product has been shown by our group and others to form an E3 ubiquitin ligase complex that contains elongins B and
Jake D Howden et al.
BMC biology, 19(1), 130-130 (2021-06-24)
Keratinocytes form the main protective barrier in the skin to separate the underlying tissue from the external environment. In order to maintain this barrier, keratinocytes form robust junctions between neighbouring cells as well as with the underlying extracellular matrix. Cell-cell
Chi Ying Cheng et al.
Journal of virology, 85(2), 765-775 (2010-11-12)
Although human adenovirus type 5 (Ad5) has been widely studied, relatively little work has been done with other human adenovirus serotypes. The Ad5 E4orf6 and E1B55K proteins form Cul5-based E3 ubiquitin ligase complexes to degrade p53, Mre11, DNA ligase IV
Role of integrins in the assembly and function of hensin in intercalated cells.
Vijayakumar, S; Erdjument-Bromage, H; Tempst, P; Al-Awqati, Q
Journal of the American Society of Nephrology null

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique