Skip to Content
Merck
All Photos(3)

Documents

WH0054455M2

Sigma-Aldrich

Monoclonal Anti-FBXO42 antibody produced in mouse

clone 2F10, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-F-box protein 42, Anti-Fbx42, Anti-KIAA1332

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2F10, monoclonal

form

buffered aqueous solution

species reactivity

human, mouse, rat

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FBXO42(54455)

General description

Members of the F-box protein family, such as FBXO42, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM

Immunogen

FBXO42 (NP_061867, 619 a.a. ~ 717 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKYYPKTNALYFVRAKR

Biochem/physiol Actions

FBXO42 (F-box protein 42) works in the ubiquitin-proteasome system and is involved in protein degradation. It mainly participates in the assembly of the SCF (skp, cullin, F-box containing) complex. FBXO42 is responsible for the ubiquitination and subsequent degradation of p53. It is also involved in the ubiquitination and degradation of ING4 (inhibitor of growth family member 4), thereby enhancing angiogenesis and metastasis of breast cancer. FBXO42 might be associated with Parkinson′s disease (PD).

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Ruorong Yan et al.
Genes & development, 29(6), 672-685 (2015-03-21)
Loss of function/dysregulation of inhibitor of growth 4 (ING4) and hyperactivation of NF-κB are frequent events in many types of human malignancies. However, the molecular mechanisms underlying these remarkable aberrations are not understood. Here, we report that ING4 is physically
Kai Gao et al.
BMC neurology, 13, 125-125 (2013-09-26)
Parkinson's disease (PD), the second most common neurodegenerative disease, is characterized by loss of dopaminergic neurons in the substantia nigra. The clinical manifestations of PD encompass a variety of motor and non-motor symptoms. Mutations in the F-box protein 7 gene
Luyang Sun et al.
Proceedings of the National Academy of Sciences of the United States of America, 106(25), 10195-10200 (2009-06-11)
The p53 tumor suppressor plays a central role in integrating cellular responses to various stresses. Tight regulation of p53 is thus essential for the maintenance of genome integrity and normal cell proliferation. Currently, several ubiquitin ligases, including the single-subunit RING-finger
Luyang Sun et al.
The Journal of biological chemistry, 286(6), 4226-4235 (2010-12-04)
The p53 tumor suppressor plays a central role in integrating cellular responses to various stresses. Tight regulation of p53 is thus essential for the maintenance of genome integrity and normal cell proliferation. Previously, we reported that JFK, the only Kelch

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service