Skip to Content
Merck
All Photos(1)

Key Documents

WH0023404M6

Sigma-Aldrich

Monoclonal Anti-EXOSC2 antibody produced in mouse

clone 4B6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-RRP4, Anti-Rrp4p, Anti-exosome component 2, Anti-hRrp4p, Anti-p7

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
€489.00

€489.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μG
€489.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€489.00


Please contact Customer Service for Availability

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4B6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... EXOSC2(23404)

General description

EXOSC2 (Exosome component 2) is a non-catalytic subunit of the eukaryotic RNA exosome. It is localized in the nucleus and in the cytoplasm.

Immunogen

EXOSC2 (NP_055100, 71 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRS

Biochem/physiol Actions

EXOSC2 (Exosome component 2) is associated with several cellular processes such as rRNA processing, RNA degradation from the 3′ end, 3′ to 5′ decay of the mRNA body after its deadenylation. Exosome complex is an ~400kDa multimeric complex, which plays a vital role in substrate recognition. EXOSC2 functions as a cofactor in the maintenance of human exosome integrity and efficient degradation and/or metabolism of various RNA classes.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Daniel L Kiss et al.
RNA (New York, N.Y.), 16(4), 781-791 (2010-02-27)
The RNA processing exosome complex was originally defined as an evolutionarily conserved multisubunit complex of ribonucleases responsible for the processing and/or turnover of stable RNAs. The exosome complex is also involved in the surveillance of mRNAs in both the nucleus
Rafal Tomecki et al.
The EMBO journal, 29(14), 2342-2357 (2010-06-10)
The eukaryotic RNA exosome is a ribonucleolytic complex involved in RNA processing and turnover. It consists of a nine-subunit catalytically inert core that serves a structural function and participates in substrate recognition. Best defined in Saccharomyces cerevisiae, enzymatic activity comes

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service