CCK codes for cholecystokinin. It is a brain/gut peptide. This gene is located on human chromosome 3p22.
Immunogen
Synthetic peptide directed towards the middle region of human CCK
Application
Anti-CCK antibody produced in rabbit has been used in staining.
Biochem/physiol Actions
Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.
Sequence
Synthetic peptide located within the following region: IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Role of CCK/gastrin receptors in gastrointestinal/metabolic diseases and results of human studies using gastrin/CCK receptor agonists/antagonists in these diseases
Berna MJ, et al.
Current Topics in Medicinal Chemistry, 7(12), 1211-1211 (2007)
Alteration of Interneuron Immunoreactivity and Autophagic Activity in Rat Hippocampus after Single High-Dose Whole-Brain Irradiation
Ouyang YB, et al.
Cureus, 9(6) (2017)
3p22. 1p21. 31 microdeletion identifies CCK as Asperger syndrome candidate gene and shows the way for therapeutic strategies in chromosome imbalances
Iourov IY, et al.
Molecular Cytogenetics, 8(1), 82-82 (2015)
Cleavage of arginyl-arginine and lysyl-arginine from the C-terminus of pro-hormone peptides by human germinal angiotensin I-converting enzyme (ACE) and the C-domain of human somatic ACE
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
