Skip to Content
Merck
All Photos(2)

Key Documents

HPA005659

Sigma-Aldrich

Anti-NSD3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-FLJ20353, Anti-KMT3F, Anti-WHISTLE, Anti-WHSC1L1, Anti-Histone-lysine N-methyltransferase NSD3 antibody produced in rabbit, Anti-Nuclear SET domain-containing protein 3 antibody produced in rabbit, Anti-WHSC1-like 1 isoform 9 with methyltransferase activity to lysine antibody produced in rabbit, Anti-WHSC1-like protein 1 antibody produced in rabbit, Anti-Whistle antibody produced in rabbit, Anti-Wolf-Hirschhorn syndrome candidate 1-like protein 1 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€540.00

€540.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
€540.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

€540.00


Please contact Customer Service for Availability

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

MMRCLRCPVAYHSGDACIAAGSMLVSSYILICSNHSKRSSNSSAVNVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNRAELMKLPMIPSSSASKKKCEKGGRLLCCESCPASFHPECLSIEMPEGCWNC

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... WHSC1L1(54904)

General description

Wolf-Hirschhorn syndrome candidate 1-like 1 (WHSC1L1) is a protein containing 700 amino acids, a SET domain and PHD finger. The gene encoding it has 23 coding exons and spans more than 90kb of genomic DNA.

Immunogen

nuclear receptor binding SET domain protein 3 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Wolf-Hirschhorn syndrome candidate 1-like 1 (WHSC1L1) has an important role in embryonic development and in cancer development, when it functions abnormally. It has a histone methyltransferase activity. WHSC1L1 methylates Lys-4 and Lys-27 of histone H3. H3 Lys-4 methylation represents a tag for epigenetic transcriptional activation, while Lys-27 marks for transcriptional repression. It forms a complex with lysine demethylase 2 (LSD2) and G9a (a H3K9-specific methyltransferase) in vivo and localizes to the gene bodies of actively transcribed genes. These together coordinate modifications at H3K4, H3K9, and H3K36 during elongation for optimal transcription.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST85173

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Sung Mi Kim et al.
Biochemical and biophysical research communications, 345(1), 318-323 (2006-05-10)
Evolutionary conserved SET domains were originally identified in three Drosophila proteins: suppressor of variegation (Su (var) 3-9), enhancer of zeste (E(z)), and the trithorax. Some of the SET-domain containing proteins have been known to elicit methylation of histone lysine residues.
P O Angrand et al.
Genomics, 74(1), 79-88 (2001-05-26)
We describe the isolation and characterization of NSD3, the third member of a gene family including Nsd1 and NSD2. Murine Nsd1 was isolated in a search for proteins that interact with the ligand-binding domain of retinoic acid receptor alpha. NSD2
Chao He et al.
The Journal of biological chemistry, 288(7), 4692-4703 (2012-12-28)
The NSD (nuclear receptor SET domain-containing) family members, consisting of NSD1, NSD2 (MMSET/WHSC1), and NSD3 (WHSC1L1), are SET domain-containing methyltransferases and aberrant expression of each member has been implicated in multiple diseases. They have specific mono- and dimethylase activities for
I Stec et al.
Genomics, 76(1-3), 5-8 (2001-09-11)
We have identified and characterized a gene (60% on protein level) and a pseudogene (93% on DNA level) that show high similarity to the Wolf-Hirschhorn syndrome candidate gene-1 (WHSC1). These genes, WHSC1L1 and WHSC1L2P, map to human chromosomes 8p11.2 and
Characteristics and Prognosis of 8p11.23-Amplified Squamous Lung Carcinomas.
Voutsadakis
Journal of clinical medicine, 12 (2023)

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service