Skip to Content
Merck
All Photos(3)

Key Documents

AV49458

Sigma-Aldrich

Anti-TRPV5 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-CAT2, Anti-ECAC1, Anti-OTRPC3, Anti-Transient receptor potential cation channel, subfamily V, member 5

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

82 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TRPV5(56302)

General description

Transient receptor potential cation channel, subfamily V, member 5 (TRPV5) belongs to transient receptor potential (TRP) cation channels family. All TRP channels contain transmembrane helices and CaM (calmodulin) binding sites. TRPV5 is highly expressed in kidney, small intestine and pancreas. Low levels of TRPV5 are observed in testis, prostate, placenta, brain, colon and rectum. TRPV5 has also been reported in human parathyroid glands.[1] The protein mianly localizes at the plasma membrane.

Immunogen

Synthetic peptide directed towards the N terminal region of human TRPV5

Application

Anti-TRPV5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

Transient receptor potential cation channel, subfamily V, member 5 (TRPV5) is an epithelial transmembrane calcium-selective channel. TRPV5 mediates renal calcium reabsorption[2] and mutations in this gene result in hypercalciuria.[3] TRPV5 also controls levels of cadmium and zinc in cells. WNK3, the With No Lysine (K) family membre, positively regulate TRPV5.

Sequence

Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Gergely Kovacs et al.
Cell calcium, 54(4), 276-286 (2013-08-24)
TRPV5 and TRPV6 are two major calcium transport pathways in the human body maintaining calcium homeostasis. TRPV5 is mainly expressed in the distal convoluted and connecting tubule where it is the major, regulated pathway for calcium reabsorption. TRPV6 serves as
Laura Giusti et al.
Journal of cellular and molecular medicine, 18(10), 1944-1952 (2014-08-29)
The parathyroid glands play an overall regulatory role in the systemic calcium (Ca(2+)) homeostasis. The purpose of the present study was to demonstrate the presence of the Ca(2+) channels transient receptor potential vanilloid (TRPV) 5 and TRPV6 in human parathyroid
Nadezda V Kovalevskaya et al.
Journal of structural and functional genomics, 13(2), 91-100 (2012-02-23)
The epithelial Ca(2+) channels TRPV5/6 (transient receptor potential vanilloid 5/6) are thoroughly regulated in order to fine-tune the amount of Ca(2+) reabsorption. Calmodulin has been shown to be involved into calcium-dependent inactivation of TRPV5/6 channels by binding directly to the
Nellie Y Loh et al.
PloS one, 8(1), e55412-e55412 (2013-02-06)
Hypercalciuria is a major cause of nephrolithiasis, and is a common and complex disorder involving genetic and environmental factors. Identification of genetic factors for monogenic forms of hypercalciuria is hampered by the limited availability of large families, and to facilitate
Wei Zhang et al.
American journal of physiology. Renal physiology, 295(5), F1472-F1484 (2008-09-05)
WNK3, a member of the With No Lysine (K) family of protein serine/threonine kinases, was shown to regulate members of the SLC12A family of cation-chloride cotransporters and the renal outer medullary K+ channel ROMK and Cl(-) channel SLC26A9. To evaluate

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service